IGF LongR 1000 mcg

IGF1 LR3 (Long R3 Insulin-like Growth Factor) is a polypeptide hormone with properties similar to insulin. However, LR3 is a modified form of IGF1 to increase half-life and to prevent deactivation due to protein binding. IGF1 LR3 contains 83 amino acids with substitution of Arginine instead of Glutamic acid at position 3. Altered polypeptide sequence prevents protein binding and increases half-life. The biomolecule exert fat metabolizing properties in addition with transportation of glucose and amino acids into the cells to aid protein biosynthesis. Research evidences suggest that IGF1 LR3 promote muscle cell hyperplasia, increase neuro-functions and nitrogen retention in cells. The molecular weight and molecular mass of IGF1 LR3 is 9.200 and C990H1528N262O300S7, respectively.https://steroidsweden.com/
IGF1-LR3 Chemical Profile
CAS: 946870-92-4
Formula: C990H1528N262O300S7
Molecular weight: 9200
Peptide purity: > 99.0%
Chain: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA





Reviews
There are no reviews yet.